LL-37 (CAP-18) 5 mg (1 vial)
$71.99
NOTE: In some cases wherein the assigned top colors are out of stock, a different top color will be used to ensure that your order will not be delayed.
Peptides are stable at room temperature and can be stored in their original packaging for several days to weeks. For longer storage, keep them at 4 °C or colder, away from intense light. Do not shake peptides before or after reconstitution, refrigerate them, and handle with care.
LL-37 5mg should be reconstituted with bacteriostatic water (BAC).
You can purchase BAC water here:
BAC 10ml
LL-37 is a 37-amino acid cationic antimicrobial peptide (AMP) that plays a dual role in the body: as a direct pathogen neutralizer and a sophisticated immunomodulator. Its Mechanism of Action is primarily driven by its amphipathic α-helical structure. Because of its strong positive charge (+6), LL-37 is attracted to the negatively charged membranes of bacteria, viruses, and fungi. Upon contact, it inserts itself into the microbial lipid bilayer, creating transmembrane pores that lead to rapid cell lysis and death.
Beyond its “search and destroy” capabilities, LL-37 acts as a signaling molecule, modulating the inflammatory response to prevent tissue damage while simultaneously recruiting immune cells like neutrophils and T-cells to the site of injury.
Technical Specifications:
-
CAS Number: 154947-66-7
-
Sequence: [LL-37, 37 aa]
-
Molecular Formula: C205H340N60O53
-
Molecular Weight: 4493.33 g/mol
-
Purity: >99% (HPLC & Mass Spec Verified)
-
Storage: Lyophilized powder; store at -20°C for long-term stability.
Human Research & Potential Applications: LL-37 is currently one of the most studied peptides for systemic and localized recovery:
-
Advanced Wound Healing: Research shows LL-37 stimulates angiogenesis (the formation of new blood vessels) and promotes epithelial cell migration, making it a primary candidate for treating chronic ulcers and surgical wounds.
-
Antimicrobial & Antiviral Defense: Studied for its effectiveness against antibiotic-resistant strains (like MRSA) and enveloped viruses, providing a non-traditional pathway for infection control.
-
Gut Health & Biofilm Eradication: Investigated for its ability to break down tough microbial biofilms, particularly in cases of persistent gut inflammation or skin infections.
-
Immune Balance: Scientific models explore its role in rebalancing cytokine production, helping to transition the body from a pro-inflammatory state to a regenerative one.
Uncompromising Swiss Chems Quality When you buy LL-37 for research, precision is everything. Most commercially available peptides lack the structural integrity required for host defense studies. At Swiss Chems, our LL-37 is rigorously Third-Party Lab Tested to ensure the exact α-helical sequence is preserved. We provide high-purity, lyophilized vials that guarantee maximum bioactivity. Browse our LL-37 for sale and secure the gold standard in peptide research.
Would you like to move on to a popular “stacking” partner for LL-37, such as BPC-157, or shall we explore a different category like the fat-burning powerhouse AOD-9604?
Order Processing & Tracking
WE SHIP TO ALL US STATES AND INTERNATIONALLY. See full Shipping Policy
Once your order has been shipped, you will receive an email containing your tracking number.
Please note:
Tracking details may take up to 24 hours to appear in the carrier’s system.
If you do not receive your tracking information, please check your spam or junk folder before requesting it again.
Customers are responsible for monitoring shipment updates using the tracking number provided.
If you require assistance regarding your shipment, you may contact the shipping carrier directly or reach out to our support team.
